logo

nwne

Profile for site: anenglishpicnic.festivalmarketboards.co.uk



The site anenglishpicnic.festivalmarketboards.co.uk has mostly english words in its hostname. The site has not yet been fetched by our web crawler. The site is hosted on a single IP address, 66.7.218.216, and there are thousands of other sites hosted on this IP, such as www.mgigharaunda.com, revistaescenarios.com, and arensconsultores.com. The parent domain festivalmarketboards.co.uk has several other sites associated with it, for example, linzyloos....almarketboards.co.uk, kitchnthin...almarketboards.co.uk, and angelasnig...almarketboards.co.uk.


Web dictionary words in site hostname:

  •   No matches found.

Last load HTTP status:

  •   Unknown.

IP this site is hosted on:

  1.   66.7.218.216 (1,879 sites on IP)

Parent domain of this site:


Name servers of this site:

  1.   ns19.urlnameserver.com (1,309 sites on name server)
  2.   ns20.urlnameserver.com (1,307 sites on name server)

Anchor text pointing to this site:

  1.   an english picnic

Referers directly linking to pages on this site:

  1.   http://www.festivalmarketboards.co.uk/
swse

nwne
Search for a site:  

Examples:     keyword     domain.com     http://www.domain.org/     sub.domain.net
swse

  Find previously loved domains to re-register for yourself at Derelict Domains